SCOP 1.75: Domain d1lzya_: 1lzy A:

Lineage for d1lzya_ (1lzy A:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (11 families)

5. Family d.2.1.2: C-type lysozyme [53960] (2 proteins)

6. Protein Lysozyme [53961] (14 species)
   ubiquitous in a variety of tissues and secretions

7. Species Turkey (Meleagris gallopavo) [TaxId:9103] [53963] (13 PDB entries)

8. Domain d1lzya_: 1lzy A: [36389]
   complexed with nag

Details for d1lzya_

PDB Entry: 1lzy, 1.55 Å

PDB Description: x-ray structure of turkey egg lysozyme complex with di-n- acetylchitobiose. recognition and binding of alpha-anomeric form

PDB Compounds: (A:) turkey egg white lysozyme

SCOP Domain Sequences for d1lzya_:

Sequence; same for both SEQRES and ATOM records:

>d1lzya_ d.2.1.2 (A:) Lysozyme {Turkey (Meleagris gallopavo) [TaxId: 9103]}
kvygrcelaaamkrlgldnyrgyslgnwvcaakfesnfnthatnrntdgstdygilqins
rwwcndgrtpgsknlcnipcsallssditasvncakkiasggngmnawvawrnrckgtdv
hawirgcrl

Timeline for d1lzya_:

• d1lzya_ first appeared (with stable ids) in SCOP 1.55, called d1lzy__
  
• d1lzya_ appears in SCOP 1.73
  
• d1lzya_ appears in SCOPe 2.01
  
• d1lzya_ appears in the current release, SCOPe 2.08