Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries) |
Domain d6hwfm_: 6hwf M: [363889] Other proteins in same PDB: d6hwfa_, d6hwfb_, d6hwfc1, d6hwfc2, d6hwfd_, d6hwfe_, d6hwff_, d6hwfg_, d6hwfi_, d6hwfj_, d6hwfk_, d6hwfl_, d6hwfn_, d6hwfo_, d6hwfp_, d6hwfq1, d6hwfq2, d6hwfr_, d6hwfs_, d6hwft_, d6hwfu_, d6hwfw_, d6hwfx_, d6hwfy_, d6hwfz_ automated match to d4j70m_ complexed with cl, gqk, mes, mg, so4; mutant |
PDB Entry: 6hwf (more details), 2.5 Å
SCOPe Domain Sequences for d6hwfm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hwfm_ d.153.1.4 (M:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgygtqki
Timeline for d6hwfm_:
View in 3D Domains from other chains: (mouse over for more information) d6hwfa_, d6hwfb_, d6hwfc1, d6hwfc2, d6hwfd_, d6hwfe_, d6hwff_, d6hwfg_, d6hwfh_, d6hwfi_, d6hwfj_, d6hwfk_, d6hwfl_, d6hwfn_, d6hwfo_, d6hwfp_, d6hwfq1, d6hwfq2, d6hwfr_, d6hwfs_, d6hwft_, d6hwfu_, d6hwfv_, d6hwfw_, d6hwfx_, d6hwfy_, d6hwfz_ |