Lineage for d6hwfm_ (6hwf M:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2993581Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)
  8. 2994153Domain d6hwfm_: 6hwf M: [363889]
    Other proteins in same PDB: d6hwfa_, d6hwfb_, d6hwfc1, d6hwfc2, d6hwfd_, d6hwfe_, d6hwff_, d6hwfg_, d6hwfi_, d6hwfj_, d6hwfk_, d6hwfl_, d6hwfn_, d6hwfo_, d6hwfp_, d6hwfq1, d6hwfq2, d6hwfr_, d6hwfs_, d6hwft_, d6hwfu_, d6hwfw_, d6hwfx_, d6hwfy_, d6hwfz_
    automated match to d4j70m_
    complexed with cl, gqk, mes, mg, so4; mutant

Details for d6hwfm_

PDB Entry: 6hwf (more details), 2.5 Å

PDB Description: yeast 20s proteasome beta2-g45a mutant in complex with onx 0914
PDB Compounds: (M:) Proteasome subunit beta type-7

SCOPe Domain Sequences for d6hwfm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hwfm_ d.153.1.4 (M:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm
qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq
sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna
mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgygtqki

SCOPe Domain Coordinates for d6hwfm_:

Click to download the PDB-style file with coordinates for d6hwfm_.
(The format of our PDB-style files is described here.)

Timeline for d6hwfm_: