Lineage for d1jsea_ (1jse A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1013435Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1013436Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1013457Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
  6. 1013515Protein Lysozyme [53961] (14 species)
    ubiquitous in a variety of tissues and secretions
  7. 1014094Species Turkey (Meleagris gallopavo) [TaxId:9103] [53963] (13 PDB entries)
  8. 1014095Domain d1jsea_: 1jse A: [36387]
    complexed with pol

Details for d1jsea_

PDB Entry: 1jse (more details), 1.12 Å

PDB Description: full-matrix least-squares refinement of turkey lysozyme
PDB Compounds: (A:) lysozyme

SCOPe Domain Sequences for d1jsea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jsea_ d.2.1.2 (A:) Lysozyme {Turkey (Meleagris gallopavo) [TaxId: 9103]}
kvygrcelaaamkrlgldnyrgyslgnwvcaakfesnfnthatnrntdgstdygilqins
rwwcndgrtpgsknlcnipcsallssditasvncakkiasggngmnawvawrnrckgtdv
hawirgcrl

SCOPe Domain Coordinates for d1jsea_:

Click to download the PDB-style file with coordinates for d1jsea_.
(The format of our PDB-style files is described here.)

Timeline for d1jsea_: