SCOP 1.65: Domain d1jse__: 1jse -

Lineage for d1jse__ (1jse -)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (7 families)

5. Family d.2.1.2: C-type lysozyme [53960] (2 proteins)

6. Protein Lysozyme [53961] (14 species)
   ubiquitous in a variety of tussues ans secretions

7. Species Turkey (Meleagris gallopavo) [TaxId:9103] [53963] (12 PDB entries)

8. Domain d1jse__: 1jse - [36387]
   complexed with pol

Details for d1jse__

PDB Entry: 1jse, 1.12 Å

PDB Description: full-matrix least-squares refinement of turkey lysozyme

SCOP Domain Sequences for d1jse__:

Sequence; same for both SEQRES and ATOM records:

>d1jse__ d.2.1.2 (-) Lysozyme {Turkey (Meleagris gallopavo)}
kvygrcelaaamkrlgldnyrgyslgnwvcaakfesnfnthatnrntdgstdygilqins
rwwcndgrtpgsknlcnipcsallssditasvncakkiasggngmnawvawrnrckgtdv
hawirgcrl

Timeline for d1jse__:

• d1jse__ first appeared (with stable ids) in SCOP 1.55
  
• d1jse__ appears in SCOP 1.63
  
• d1jse__ appears in SCOP 1.67
  
• d1jse__ appears in the current release, SCOPe 2.08, called d1jsea_