Lineage for d1lsg_1 (1lsg 1-144)
- Root: SCOP 1.59
Class d: Alpha and beta proteins (a+b) [53931] (208 folds) 
Fold d.2: Lysozyme-like [53954] (1 superfamily) Superfamily d.2.1: Lysozyme-like [53955] (7 families) 
Family d.2.1.2: C-type lysozyme [53960] (2 proteins) Protein Lysozyme [53961] (15 species) Species Chicken (Gallus gallus) [TaxId:9031] [53962] (155 PDB entries) 
Domain d1lsg_1: 1lsg 1-144 [36379]
Details for d1lsg_1
PDB Entry: 1lsg (more details), 2.4 Å
PDB Description: three-dimensional structure of the platelet integrin recognition segment of the fibrinogen gamma chain obtained by carrier protein-driven crystallization
SCOP Domain Sequences for d1lsg_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lsg_1 d.2.1.2 (1-144) Lysozyme {Chicken (Gallus gallus)}
mkvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfntqatnrntdgstdygilqin
srwwcndgrtpgsrnlcnipcsallssditasvncakkivsdgngmnawvawrnrckgtd
vqawirgcrlqqhhlggakqagdv
SCOP Domain Coordinates for d1lsg_1:
Click to download the PDB-style file with coordinates for d1lsg_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1lsg_1:
- d1lsg_1 first appeared (with stable ids) in SCOP 1.55
- d1lsg_1 appears in SCOP 1.57
- d1lsg_1 appears in SCOP 1.61
- d1lsg_1 appears in the current release, SCOPe 2.08, called d1lsga1
View in 3D