Lineage for d6hw6m_ (6hw6 M:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2993581Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)
  8. 2994541Domain d6hw6m_: 6hw6 M: [363786]
    Other proteins in same PDB: d6hw6b_, d6hw6c1, d6hw6c2, d6hw6d_, d6hw6e_, d6hw6f_, d6hw6g_, d6hw6i_, d6hw6j_, d6hw6k_, d6hw6l_, d6hw6n_, d6hw6o_, d6hw6p_, d6hw6q1, d6hw6q2, d6hw6r_, d6hw6s_, d6hw6t_, d6hw6u_, d6hw6w_, d6hw6x_, d6hw6y_, d6hw6z_
    automated match to d4j70m_
    complexed with gt5, mg

Details for d6hw6m_

PDB Entry: 6hw6 (more details), 2.7 Å

PDB Description: yeast 20s proteasome in complex with 20
PDB Compounds: (M:) Proteasome subunit beta type-7

SCOPe Domain Sequences for d6hw6m_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hw6m_ d.153.1.4 (M:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm
qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq
sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna
mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgygtqki

SCOPe Domain Coordinates for d6hw6m_:

Click to download the PDB-style file with coordinates for d6hw6m_.
(The format of our PDB-style files is described here.)

Timeline for d6hw6m_: