Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries) |
Domain d6hw6m_: 6hw6 M: [363786] Other proteins in same PDB: d6hw6b_, d6hw6c1, d6hw6c2, d6hw6d_, d6hw6e_, d6hw6f_, d6hw6g_, d6hw6i_, d6hw6j_, d6hw6k_, d6hw6l_, d6hw6n_, d6hw6o_, d6hw6p_, d6hw6q1, d6hw6q2, d6hw6r_, d6hw6s_, d6hw6t_, d6hw6u_, d6hw6w_, d6hw6x_, d6hw6y_, d6hw6z_ automated match to d4j70m_ complexed with gt5, mg |
PDB Entry: 6hw6 (more details), 2.7 Å
SCOPe Domain Sequences for d6hw6m_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hw6m_ d.153.1.4 (M:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgygtqki
Timeline for d6hw6m_:
View in 3D Domains from other chains: (mouse over for more information) d6hw6a_, d6hw6b_, d6hw6c1, d6hw6c2, d6hw6d_, d6hw6e_, d6hw6f_, d6hw6g_, d6hw6h_, d6hw6i_, d6hw6j_, d6hw6k_, d6hw6l_, d6hw6n_, d6hw6o_, d6hw6p_, d6hw6q1, d6hw6q2, d6hw6r_, d6hw6s_, d6hw6t_, d6hw6u_, d6hw6v_, d6hw6w_, d6hw6x_, d6hw6y_, d6hw6z_ |