Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries) |
Domain d6hvym_: 6hvy M: [363759] Other proteins in same PDB: d6hvyb_, d6hvyc1, d6hvyc2, d6hvyd_, d6hvye_, d6hvyf_, d6hvyg_, d6hvyi_, d6hvyj_, d6hvyk_, d6hvyl_, d6hvyn_, d6hvyo_, d6hvyp_, d6hvyq1, d6hvyq2, d6hvyr_, d6hvys_, d6hvyt_, d6hvyu_, d6hvyw_, d6hvyx_, d6hvyy_, d6hvyz_ automated match to d4j70m_ complexed with cl, gvz, gw2, mes, mg |
PDB Entry: 6hvy (more details), 2.7 Å
SCOPe Domain Sequences for d6hvym_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hvym_ d.153.1.4 (M:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgygtqki
Timeline for d6hvym_:
View in 3D Domains from other chains: (mouse over for more information) d6hvya_, d6hvyb_, d6hvyc1, d6hvyc2, d6hvyd_, d6hvye_, d6hvyf_, d6hvyg_, d6hvyh_, d6hvyi_, d6hvyj_, d6hvyk_, d6hvyl_, d6hvyn_, d6hvyo_, d6hvyp_, d6hvyq1, d6hvyq2, d6hvyr_, d6hvys_, d6hvyt_, d6hvyu_, d6hvyv_, d6hvyw_, d6hvyx_, d6hvyy_, d6hvyz_ |