Lineage for d6hvym_ (6hvy M:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2993581Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)
  8. 2994406Domain d6hvym_: 6hvy M: [363759]
    Other proteins in same PDB: d6hvyb_, d6hvyc1, d6hvyc2, d6hvyd_, d6hvye_, d6hvyf_, d6hvyg_, d6hvyi_, d6hvyj_, d6hvyk_, d6hvyl_, d6hvyn_, d6hvyo_, d6hvyp_, d6hvyq1, d6hvyq2, d6hvyr_, d6hvys_, d6hvyt_, d6hvyu_, d6hvyw_, d6hvyx_, d6hvyy_, d6hvyz_
    automated match to d4j70m_
    complexed with cl, gvz, gw2, mes, mg

Details for d6hvym_

PDB Entry: 6hvy (more details), 2.7 Å

PDB Description: yeast 20s proteasome in complex with 5 (7- and 6-membered ring)
PDB Compounds: (M:) Proteasome subunit beta type-7

SCOPe Domain Sequences for d6hvym_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hvym_ d.153.1.4 (M:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm
qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq
sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna
mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgygtqki

SCOPe Domain Coordinates for d6hvym_:

Click to download the PDB-style file with coordinates for d6hvym_.
(The format of our PDB-style files is described here.)

Timeline for d6hvym_: