Lineage for d6hvad_ (6hva D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2993581Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)
  8. 2994881Domain d6hvad_: 6hva D: [363758]
    Other proteins in same PDB: d6hvac2, d6hvae_, d6hvag_, d6hvai_, d6hvaj_, d6hvak_, d6hval_, d6hvan_, d6hvao_, d6hvaq2, d6hvas_, d6hvau_, d6hvaw_, d6hvax_, d6hvay_, d6hvaz_
    automated match to d1rype_
    complexed with cl, gqt, mg

Details for d6hvad_

PDB Entry: 6hva (more details), 2.9 Å

PDB Description: yeast 20s proteasome with human beta2i (1-53) in complex with 13
PDB Compounds: (D:) Proteasome subunit alpha type-5

SCOPe Domain Sequences for d6hvad_:

Sequence, based on SEQRES records: (download)

>d6hvad_ d.153.1.4 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas
geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh
ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea
ae

Sequence, based on observed residues (ATOM records): (download)

>d6hvad_ d.153.1.4 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgelms
rpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewhssltlke
aellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekeaae

SCOPe Domain Coordinates for d6hvad_:

Click to download the PDB-style file with coordinates for d6hvad_.
(The format of our PDB-style files is described here.)

Timeline for d6hvad_: