Lineage for d6hvvx_ (6hvv X:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2548925Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2549037Protein Proteasome alpha subunit (non-catalytic) [56255] (9 species)
    contains an extension to the common fold at the N-terminus
  7. 2549053Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (235 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 3063680Domain d6hvvx_: 6hvv X: [363742]
    Other proteins in same PDB: d6hvvc_, d6hvvd_, d6hvvf_, d6hvvg_, d6hvvh_, d6hvvm_, d6hvvp_, d6hvvq_, d6hvvr_, d6hvvt_, d6hvvu_, d6hvvv_
    automated match to d4j70j_
    complexed with cl, gt8, mes, mg

Details for d6hvvx_

PDB Entry: 6hvv (more details), 2.7 Å

PDB Description: yeast 20s proteasome with human beta2i (1-53) in complex with 39
PDB Compounds: (X:) Proteasome subunit beta type-4

SCOPe Domain Sequences for d6hvvx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hvvx_ d.153.1.4 (X:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mdiilgirvqdsvilasskavtrgisvlkdsddktrqlsphtlmsfageagdtvqfaeyi
qaniqlysiredyelspqavssfvrqelaksirsrrpyqvnvliggydkkknkpelyqid
ylgtkvelpygahgysgfytfslldhhyrpdmtteegldllklcvqelekrmpmdfkgvi
vkivdkdgirqvddf

SCOPe Domain Coordinates for d6hvvx_:

Click to download the PDB-style file with coordinates for d6hvvx_.
(The format of our PDB-style files is described here.)

Timeline for d6hvvx_:

  • d6hvvx_ appears in periodic updates to SCOPe 2.07 starting on 2019-02-08