Lineage for d6hvxa_ (6hvx a:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2548925Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2552691Protein automated matches [190144] (11 species)
    not a true protein
  7. 2552960Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (197 PDB entries)
  8. 3063617Domain d6hvxa_: 6hvx a: [363679]
    Other proteins in same PDB: d6hvxb_, d6hvxc_, d6hvxd_, d6hvxe_, d6hvxf_, d6hvxg_, d6hvxi_, d6hvxj_, d6hvxk_, d6hvxl_, d6hvxn_, d6hvxo_, d6hvxp_, d6hvxq_, d6hvxr_, d6hvxs_, d6hvxt_, d6hvxu_, d6hvxw_, d6hvxx_, d6hvxy_, d6hvxz_
    automated match to d4j70m_
    complexed with cl, gqh, mg

Details for d6hvxa_

PDB Entry: 6hvx (more details), 2.8 Å

PDB Description: yeast 20s proteasome in complex with 4
PDB Compounds: (a:) Proteasome subunit beta type-7

SCOPe Domain Sequences for d6hvxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hvxa_ d.153.1.4 (a:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm
qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq
sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna
mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgygtqki

SCOPe Domain Coordinates for d6hvxa_:

Click to download the PDB-style file with coordinates for d6hvxa_.
(The format of our PDB-style files is described here.)

Timeline for d6hvxa_:

  • d6hvxa_ appears in periodic updates to SCOPe 2.07 starting on 2019-02-07