SCOPe 2.08: Domain d6hvuz_: 6hvu Z:

Lineage for d6hvuz_ (6hvu Z:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome beta subunit (catalytic) [56252] (7 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (202 PDB entries)
   The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)

8. Domain d6hvuz_: 6hvu Z: [363665]
   Other proteins in same PDB: d6hvua_, d6hvuc1, d6hvuc2, d6hvud_, d6hvue_, d6hvuf_, d6hvug_, d6hvuh_, d6hvum_, d6hvuo_, d6hvup_, d6hvuq1, d6hvuq2, d6hvur_, d6hvus_, d6hvut_, d6hvuu_, d6hvuv_
   automated match to d1rypm_
   complexed with cl, gtw, mg

Details for d6hvuz_

PDB Entry: 6hvu, 2.9 Å

PDB Description: yeast 20s proteasome with human beta2i (1-53) in complex with 29

PDB Compounds: (Z:) Proteasome subunit beta type-6

SCOPe Domain Sequences for d6hvuz_:

Sequence; same for both SEQRES and ATOM records:

>d6hvuz_ d.153.1.4 (Z:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qfnpygdnggtilgiagedfavlagdtrnitdysinsryepkvfdcgdnivmsangfaad
gdalvkrfknsvkwyhfdhndkklsinsaarniqhllygkrffpyyvhtiiagldedgkg
avysfdpvgsyereqcraggaaaslimpfldnqvnfknqyepgtngkvkkplkylsveev
iklvrdsftsaterhiqvgdgleilivtkdgvrkefyelkrd

Timeline for d6hvuz_:

• d6hvuz_ first appeared in SCOPe 2.07