Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries) |
Domain d6hvvt_: 6hvv T: [363659] Other proteins in same PDB: d6hvva_, d6hvvb_, d6hvvc2, d6hvve_, d6hvvg_, d6hvvi_, d6hvvj_, d6hvvk_, d6hvvl_, d6hvvn_, d6hvvo_, d6hvvq2, d6hvvs_, d6hvvu_, d6hvvw_, d6hvvx_, d6hvvy_, d6hvvz_ automated match to d4g4sg_ complexed with cl, gt8, mes, mg |
PDB Entry: 6hvv (more details), 2.7 Å
SCOPe Domain Sequences for d6hvvt_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hvvt_ d.153.1.4 (T:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} tgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknv kiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtl ynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpe glsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqk ein
Timeline for d6hvvt_:
View in 3D Domains from other chains: (mouse over for more information) d6hvva_, d6hvvb_, d6hvvc1, d6hvvc2, d6hvvd_, d6hvve_, d6hvvf_, d6hvvg_, d6hvvh_, d6hvvi_, d6hvvj_, d6hvvk_, d6hvvl_, d6hvvm_, d6hvvn_, d6hvvo_, d6hvvp_, d6hvvq1, d6hvvq2, d6hvvr_, d6hvvs_, d6hvvu_, d6hvvv_, d6hvvw_, d6hvvx_, d6hvvy_, d6hvvz_ |