SCOPe 2.08: Domain d6hv4f_: 6hv4 F:

Lineage for d6hv4f_ (6hv4 F:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (14 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)

8. Domain d6hv4f_: 6hv4 F: [363656]
   Other proteins in same PDB: d6hv4a_, d6hv4c2, d6hv4e_, d6hv4g_, d6hv4i_, d6hv4j_, d6hv4k_, d6hv4l_, d6hv4n_, d6hv4o_, d6hv4q2, d6hv4s_, d6hv4u_, d6hv4w_, d6hv4x_, d6hv4y_, d6hv4z_
   automated match to d4g4sg_
   complexed with cl, gqk, mes, mg, so4

Details for d6hv4f_

PDB Entry: 6hv4, 3 Å

PDB Description: yeast 20s proteasome with human beta2i (1-53) in complex with onx 0914

PDB Compounds: (F:) probable proteasome subunit alpha type-7

SCOPe Domain Sequences for d6hv4f_:

Sequence; same for both SEQRES and ATOM records:

>d6hv4f_ d.153.1.4 (F:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknv
kiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtl
ynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpe
glsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqk
ein

Timeline for d6hv4f_:

• d6hv4f_ first appeared in SCOPe 2.07