Lineage for d6hv5u_ (6hv5 U:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2554828Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2554829Protein automated matches [190509] (15 species)
    not a true protein
  7. 2554883Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (108 PDB entries)
  8. 3063591Domain d6hv5u_: 6hv5 U: [363653]
    Other proteins in same PDB: d6hv5a_, d6hv5b_, d6hv5c_, d6hv5d_, d6hv5e_, d6hv5f_, d6hv5h_, d6hv5i_, d6hv5j_, d6hv5k_, d6hv5l_, d6hv5m_, d6hv5n_, d6hv5o_, d6hv5p_, d6hv5q_, d6hv5r_, d6hv5s_, d6hv5t_, d6hv5v_, d6hv5w_, d6hv5x_, d6hv5y_, d6hv5z_
    automated match to d1irua_
    complexed with cl, gqh, mg

Details for d6hv5u_

PDB Entry: 6hv5 (more details), 3 Å

PDB Description: yeast 20s proteasome with human beta2i (1-53) in complex with 4
PDB Compounds: (U:) Proteasome subunit alpha type-1

SCOPe Domain Sequences for d6hv5u_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hv5u_ d.153.1.0 (U:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttvs
yifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiytq
raymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkksk
idhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaiae
q

SCOPe Domain Coordinates for d6hv5u_:

Click to download the PDB-style file with coordinates for d6hv5u_.
(The format of our PDB-style files is described here.)

Timeline for d6hv5u_:

  • d6hv5u_ appears in periodic updates to SCOPe 2.07 starting on 2019-02-07