Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries) |
Domain d6hvah_: 6hva H: [363639] Other proteins in same PDB: d6hvac2, d6hvae_, d6hvag_, d6hvai_, d6hvaj_, d6hvak_, d6hval_, d6hvan_, d6hvao_, d6hvaq2, d6hvas_, d6hvau_, d6hvaw_, d6hvax_, d6hvay_, d6hvaz_ automated match to d5fg9h_ complexed with cl, gqt, mg |
PDB Entry: 6hva (more details), 2.9 Å
SCOPe Domain Sequences for d6hvah_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hvah_ d.153.1.4 (H:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} ttiaglvfqdgvilgadtratndsvvadkscekihfiapkiyccgagvaadaeavtqlig snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei gkdaeylrnyltpnvreekqksykfprgttavlkesivnicdiqee
Timeline for d6hvah_:
View in 3D Domains from other chains: (mouse over for more information) d6hvaa_, d6hvab_, d6hvac1, d6hvac2, d6hvad_, d6hvae_, d6hvaf_, d6hvag_, d6hvai_, d6hvaj_, d6hvak_, d6hval_, d6hvam_, d6hvan_, d6hvao_, d6hvap_, d6hvaq1, d6hvaq2, d6hvar_, d6hvas_, d6hvat_, d6hvau_, d6hvav_, d6hvaw_, d6hvax_, d6hvay_, d6hvaz_ |