Lineage for d6hv4c_ (6hv4 C:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2548925Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2552691Protein automated matches [190144] (11 species)
    not a true protein
  7. 2552960Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (197 PDB entries)
  8. 3063550Domain d6hv4c_: 6hv4 C: [363612]
    Other proteins in same PDB: d6hv4a_, d6hv4e_, d6hv4g_, d6hv4i_, d6hv4j_, d6hv4k_, d6hv4l_, d6hv4n_, d6hv4o_, d6hv4s_, d6hv4u_, d6hv4w_, d6hv4x_, d6hv4y_, d6hv4z_
    automated match to d1rypd_
    complexed with cl, gqk, mes, mg, so4

Details for d6hv4c_

PDB Entry: 6hv4 (more details), 3 Å

PDB Description: yeast 20s proteasome with human beta2i (1-53) in complex with onx 0914
PDB Compounds: (C:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d6hv4c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hv4c_ d.153.1.4 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe

SCOPe Domain Coordinates for d6hv4c_:

Click to download the PDB-style file with coordinates for d6hv4c_.
(The format of our PDB-style files is described here.)

Timeline for d6hv4c_:

  • d6hv4c_ appears in periodic updates to SCOPe 2.07 starting on 2019-02-07