Lineage for d6hvti_ (6hvt I:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2548925Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2550690Protein Proteasome beta subunit (catalytic) [56252] (7 species)
  7. 2550699Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (199 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 3063532Domain d6hvti_: 6hvt I: [363594]
    Other proteins in same PDB: d6hvta_, d6hvtc_, d6hvtd_, d6hvte_, d6hvtf_, d6hvtg_, d6hvth_, d6hvtm_, d6hvto_, d6hvtp_, d6hvtq_, d6hvtr_, d6hvts_, d6hvtt_, d6hvtu_, d6hvtv_
    automated match to d1g0ui_
    complexed with cl, gt5, mg

Details for d6hvti_

PDB Entry: 6hvt (more details), 2.9 Å

PDB Description: yeast 20s proteasome with human beta2i (1-53) in complex with 20
PDB Compounds: (I:) Proteasome subunit beta type-3

SCOPe Domain Sequences for d6hvti_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hvti_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sdpssinggivvamtgkdcvaiacdlrlgsqslgvsnkfekifhyghvflgitglatdvt
tlnemfryktnlyklkeeraiepetftqlvssslyerrfgpyfvgpvvaginsksgkpfi
agfdligcideakdfivsgtasdqlfgmceslyepnlepedlfetisqallnaadrdals
gwgavvyiikkdevvkrylkmrqd

SCOPe Domain Coordinates for d6hvti_:

Click to download the PDB-style file with coordinates for d6hvti_.
(The format of our PDB-style files is described here.)

Timeline for d6hvti_:

  • d6hvti_ appears in periodic updates to SCOPe 2.07 starting on 2019-02-07