SCOPe 2.08: Domain d6hvvc1: 6hvv C:1-234

Lineage for d6hvvc1 (6hvv C:1-234)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (14 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)

8. Domain d6hvvc1: 6hvv C:1-234 [363581]
   Other proteins in same PDB: d6hvva_, d6hvvb_, d6hvvc2, d6hvve_, d6hvvg_, d6hvvi_, d6hvvj_, d6hvvk_, d6hvvl_, d6hvvn_, d6hvvo_, d6hvvq2, d6hvvs_, d6hvvu_, d6hvvw_, d6hvvx_, d6hvvy_, d6hvvz_
   automated match to d1rypd_
   complexed with cl, gt8, mes, mg

Details for d6hvvc1

PDB Entry: 6hvv, 2.7 Å

PDB Description: yeast 20s proteasome with human beta2i (1-53) in complex with 39

PDB Compounds: (C:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d6hvvc1:

Sequence; same for both SEQRES and ATOM records:

>d6hvvc1 d.153.1.4 (C:1-234) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqi

Timeline for d6hvvc1:

• d6hvvc1 first appeared in SCOPe 2.07, called d6hvvc_