Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries) |
Domain d6huvr_: 6huv R: [363560] Other proteins in same PDB: d6huvc2, d6huve_, d6huvg_, d6huvi_, d6huvj_, d6huvk_, d6huvl_, d6huvn_, d6huvo_, d6huvq2, d6huvs_, d6huvu_, d6huvw_, d6huvx_, d6huvy_, d6huvz_ automated match to d1rype_ complexed with cl, gt8, mes, mg, so4 |
PDB Entry: 6huv (more details), 3.1 Å
SCOPe Domain Sequences for d6huvr_:
Sequence, based on SEQRES records: (download)
>d6huvr_ d.153.1.4 (R:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea ae
>d6huvr_ d.153.1.4 (R:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgelms rpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewhssltlke aellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekeaae
Timeline for d6huvr_:
View in 3D Domains from other chains: (mouse over for more information) d6huva_, d6huvb_, d6huvc1, d6huvc2, d6huvd_, d6huve_, d6huvf_, d6huvg_, d6huvh_, d6huvi_, d6huvj_, d6huvk_, d6huvl_, d6huvm_, d6huvn_, d6huvo_, d6huvp_, d6huvq1, d6huvq2, d6huvs_, d6huvt_, d6huvu_, d6huvv_, d6huvw_, d6huvx_, d6huvy_, d6huvz_ |