SCOP 1.73: Domain d1kxwa_: 1kxw A:

Lineage for d1kxwa_ (1kxw A:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (7 families)

5. Family d.2.1.2: C-type lysozyme [53960] (2 proteins)

6. Protein Lysozyme [53961] (14 species)
   ubiquitous in a variety of tissues and secretions

7. Species Chicken (Gallus gallus) [TaxId:9031] [53962] (256 PDB entries)

8. Domain d1kxwa_: 1kxw A: [36355]
   mutant

Details for d1kxwa_

PDB Entry: 1kxw, 1.96 Å

PDB Description: analysis of the stabilization of hen lysozyme with the helix dipole and charged side chains

PDB Compounds: (A:) lysozyme

SCOP Domain Sequences for d1kxwa_:

Sequence; same for both SEQRES and ATOM records:

>d1kxwa_ d.2.1.2 (A:) Lysozyme {Chicken (Gallus gallus) [TaxId: 9031]}
kvfgrcelaaamkrhgldnyrgyslgdwvcaakfesnfntqatnrntdgstdygilqins
rwwcndgrtpgsrnlcnipcsallssditasvncakkivsdgngmnawvawrnrckgtdv
qawirgcrl

Timeline for d1kxwa_:

• d1kxwa_ first appeared (with stable ids) in SCOP 1.55, called d1kxw__
  
• d1kxwa_ was called d1kxw__ in SCOP 1.71
  
• d1kxwa_ appears in SCOP 1.75
  
• d1kxwa_ appears in the current release, SCOPe 2.08