SCOPe 2.07: Domain d6htcc_: 6htc C:

Lineage for d6htcc_ (6htc C:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome alpha subunit (non-catalytic) [56255] (10 species)
   contains an extension to the common fold at the N-terminus

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (242 PDB entries)
   The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)

8. Domain d6htcc_: 6htc C: [363532]
   Other proteins in same PDB: d6htch_, d6htci_, d6htcj_, d6htck_, d6htcl_, d6htcm_, d6htcn_, d6htcv_, d6htcw_, d6htcx_, d6htcy_, d6htcz_
   automated match to d4cr2d_
   complexed with cl, gqk, mes, mg, so4

Details for d6htcc_

PDB Entry: 6htc, 2.8 Å

PDB Description: yeast 20s proteasome with human beta2c (s171g) in complex with onx 0914

PDB Compounds: (C:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d6htcc_:

Sequence; same for both SEQRES and ATOM records:

>d6htcc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe

Timeline for d6htcc_:

• d6htcc_ is new in SCOPe 2.07-stable
  
• d6htcc_ appears in the current release, SCOPe 2.08, called d6htcc1