Lineage for d6hvyh_ (6hvy H:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2548925Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2552691Protein automated matches [190144] (11 species)
    not a true protein
  7. 2552960Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (197 PDB entries)
  8. 3063440Domain d6hvyh_: 6hvy H: [363502]
    Other proteins in same PDB: d6hvyb_, d6hvyc_, d6hvyd_, d6hvye_, d6hvyf_, d6hvyg_, d6hvyi_, d6hvyj_, d6hvyk_, d6hvyl_, d6hvyn_, d6hvyo_, d6hvyp_, d6hvyq_, d6hvyr_, d6hvys_, d6hvyt_, d6hvyu_, d6hvyw_, d6hvyx_, d6hvyy_, d6hvyz_
    automated match to d5fg9h_
    complexed with cl, gvz, gw2, mes, mg

Details for d6hvyh_

PDB Entry: 6hvy (more details), 2.7 Å

PDB Description: yeast 20s proteasome in complex with 5 (7- and 6-membered ring)
PDB Compounds: (H:) Proteasome subunit beta type-2

SCOPe Domain Sequences for d6hvyh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hvyh_ d.153.1.4 (H:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
gkdaeylrnyltpnvreekqksykfprgttavlkesivnicdiqee

SCOPe Domain Coordinates for d6hvyh_:

Click to download the PDB-style file with coordinates for d6hvyh_.
(The format of our PDB-style files is described here.)

Timeline for d6hvyh_:

  • d6hvyh_ appears in periodic updates to SCOPe 2.07 starting on 2019-02-06