Lineage for d1uiea_ (1uie A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1013435Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1013436Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1013457Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
  6. 1013515Protein Lysozyme [53961] (14 species)
    ubiquitous in a variety of tissues and secretions
  7. 1013523Species Chicken (Gallus gallus) [TaxId:9031] [53962] (273 PDB entries)
    Uniprot P00698
  8. 1013698Domain d1uiea_: 1uie A: [36349]

Details for d1uiea_

PDB Entry: 1uie (more details), 1.95 Å

PDB Description: analysis of the stabilization of hen lysozyme with the helix dipole and charged side chains
PDB Compounds: (A:) lysozyme

SCOPe Domain Sequences for d1uiea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uiea_ d.2.1.2 (A:) Lysozyme {Chicken (Gallus gallus) [TaxId: 9031]}
kvfgrcelaaamkrggldnyrgyslgnwvcaakfesnfntqatnrntdgstdygilqins
rwwcndgrtpgsrnlcnipcsallssditasvncakkivsdgngmnawvawrnrckgtdv
qawirgcrl

SCOPe Domain Coordinates for d1uiea_:

Click to download the PDB-style file with coordinates for d1uiea_.
(The format of our PDB-style files is described here.)

Timeline for d1uiea_: