Lineage for d1lsy__ (1lsy -)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.2: Lysozyme-like [53954] (1 superfamily) Superfamily d.2.1: Lysozyme-like [53955] (7 families) 
Family d.2.1.2: C-type lysozyme [53960] (2 proteins) Protein Lysozyme [53961] (16 species) Species Chicken (Gallus gallus) [TaxId:9031] [53962] (155 PDB entries) 
Domain d1lsy__: 1lsy - [36347]
Details for d1lsy__
PDB Entry: 1lsy (more details), 1.9 Å
PDB Description: crystal structure of the mutant d52s hen egg white lysozyme with an oligosaccharide product
SCOP Domain Sequences for d1lsy__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lsy__ d.2.1.2 (-) Lysozyme {Chicken (Gallus gallus)}
kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfntqatnrntdgstsygilqins
rwwcndgrtpgsrnlcnipcsallssditasvncakkivsdgngmnawvawrnrckgtdv
qawirgcrl
SCOP Domain Coordinates for d1lsy__:
Click to download the PDB-style file with coordinates for d1lsy__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1lsy__:
- d1lsy__ first appeared (with stable ids) in SCOP 1.55
- d1lsy__ appears in SCOP 1.59
- d1lsy__ appears in SCOP 1.63
- d1lsy__ appears in the current release, SCOPe 2.08, called d1lsya_
View in 3D