Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [311423] (25 PDB entries) |
Domain d6htbv_: 6htb V: [363469] Other proteins in same PDB: d6htba_, d6htbb_, d6htbc1, d6htbc2, d6htbd_, d6htbe_, d6htbf_, d6htbg_, d6htbi_, d6htbj_, d6htbk_, d6htbl_, d6htbn_, d6htbo_, d6htbp_, d6htbq1, d6htbq2, d6htbr_, d6htbs_, d6htbt_, d6htbu_, d6htbw_, d6htbx_, d6htby_, d6htbz_ automated match to d5le5h_ complexed with cl, mg |
PDB Entry: 6htb (more details), 2.7 Å
SCOPe Domain Sequences for d6htbv_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6htbv_ d.153.1.4 (V:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ttiagvvykdgivlgadtrategmvvadkncskihfispniyccgagtaadtdmttqlis snlelhslstgrlprvvtanrmlkqmlfryqgyigaalvlggvdvtgphlysiyphgstd klpyvtmgsgslaamavfedkfrpdmeeeeaknlvseaiaagifndlgsggnidlcvisk nkldflrpytvpnkkgtrlgryrcekgttavltekitpl
Timeline for d6htbv_:
View in 3D Domains from other chains: (mouse over for more information) d6htba_, d6htbb_, d6htbc1, d6htbc2, d6htbd_, d6htbe_, d6htbf_, d6htbg_, d6htbh_, d6htbi_, d6htbj_, d6htbk_, d6htbl_, d6htbm_, d6htbn_, d6htbo_, d6htbp_, d6htbq1, d6htbq2, d6htbr_, d6htbs_, d6htbt_, d6htbu_, d6htbw_, d6htbx_, d6htby_, d6htbz_ |