Lineage for d6htbv_ (6htb V:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2995063Species Human (Homo sapiens) [TaxId:9606] [311423] (25 PDB entries)
  8. 2995148Domain d6htbv_: 6htb V: [363469]
    Other proteins in same PDB: d6htba_, d6htbb_, d6htbc1, d6htbc2, d6htbd_, d6htbe_, d6htbf_, d6htbg_, d6htbi_, d6htbj_, d6htbk_, d6htbl_, d6htbn_, d6htbo_, d6htbp_, d6htbq1, d6htbq2, d6htbr_, d6htbs_, d6htbt_, d6htbu_, d6htbw_, d6htbx_, d6htby_, d6htbz_
    automated match to d5le5h_
    complexed with cl, mg

Details for d6htbv_

PDB Entry: 6htb (more details), 2.7 Å

PDB Description: yeast 20s proteasome with human beta2c (s171g)
PDB Compounds: (V:) Proteasome subunit beta type-7

SCOPe Domain Sequences for d6htbv_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6htbv_ d.153.1.4 (V:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ttiagvvykdgivlgadtrategmvvadkncskihfispniyccgagtaadtdmttqlis
snlelhslstgrlprvvtanrmlkqmlfryqgyigaalvlggvdvtgphlysiyphgstd
klpyvtmgsgslaamavfedkfrpdmeeeeaknlvseaiaagifndlgsggnidlcvisk
nkldflrpytvpnkkgtrlgryrcekgttavltekitpl

SCOPe Domain Coordinates for d6htbv_:

Click to download the PDB-style file with coordinates for d6htbv_.
(The format of our PDB-style files is described here.)

Timeline for d6htbv_: