Lineage for d6htdp_ (6htd P:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2993581Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)
  8. 2994986Domain d6htdp_: 6htd P: [363416]
    Other proteins in same PDB: d6htdc2, d6htde_, d6htdg_, d6htdi_, d6htdj_, d6htdk_, d6htdl_, d6htdn_, d6htdo_, d6htdq2, d6htds_, d6htdu_, d6htdw_, d6htdx_, d6htdy_, d6htdz_
    automated match to d4cr2c_
    complexed with cl, gqh, mg, so4

Details for d6htdp_

PDB Entry: 6htd (more details), 3 Å

PDB Description: yeast 20s proteasome with human beta2c (s171g) in complex with 4
PDB Compounds: (P:) Proteasome subunit alpha type-3

SCOPe Domain Sequences for d6htdp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6htdp_ d.153.1.4 (P:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt
steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg
ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk
ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk
tgit

SCOPe Domain Coordinates for d6htdp_:

Click to download the PDB-style file with coordinates for d6htdp_.
(The format of our PDB-style files is described here.)

Timeline for d6htdp_: