Lineage for d6htdu_ (6htd U:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2995888Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2995889Protein automated matches [190509] (19 species)
    not a true protein
  7. 2995948Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (110 PDB entries)
  8. 2996305Domain d6htdu_: 6htd U: [363381]
    Other proteins in same PDB: d6htda_, d6htdb_, d6htdc1, d6htdc2, d6htdd_, d6htde_, d6htdf_, d6htdh_, d6htdi_, d6htdj_, d6htdk_, d6htdl_, d6htdm_, d6htdn_, d6htdo_, d6htdp_, d6htdq1, d6htdq2, d6htdr_, d6htds_, d6htdt_, d6htdv_, d6htdw_, d6htdx_, d6htdy_, d6htdz_
    automated match to d1irua_
    complexed with cl, gqh, mg, so4

Details for d6htdu_

PDB Entry: 6htd (more details), 3 Å

PDB Description: yeast 20s proteasome with human beta2c (s171g) in complex with 4
PDB Compounds: (U:) Proteasome subunit alpha type-1

SCOPe Domain Sequences for d6htdu_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6htdu_ d.153.1.0 (U:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttvs
yifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiytq
raymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkksk
idhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaiae
q

SCOPe Domain Coordinates for d6htdu_:

Click to download the PDB-style file with coordinates for d6htdu_.
(The format of our PDB-style files is described here.)

Timeline for d6htdu_: