Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries) |
Domain d6htpm_: 6htp M: [363355] Other proteins in same PDB: d6htpc2, d6htpe_, d6htpg_, d6htpi_, d6htpj_, d6htpk_, d6htpl_, d6htpn_, d6htpo_, d6htpq2, d6htps_, d6htpu_, d6htpw_, d6htpx_, d6htpy_, d6htpz_ automated match to d4j70m_ complexed with cl, gqq, mg, so4 |
PDB Entry: 6htp (more details), 3 Å
SCOPe Domain Sequences for d6htpm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6htpm_ d.153.1.4 (M:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakd
Timeline for d6htpm_:
View in 3D Domains from other chains: (mouse over for more information) d6htpa_, d6htpb_, d6htpc1, d6htpc2, d6htpd_, d6htpe_, d6htpf_, d6htpg_, d6htph_, d6htpi_, d6htpj_, d6htpk_, d6htpl_, d6htpn_, d6htpo_, d6htpp_, d6htpq1, d6htpq2, d6htpr_, d6htps_, d6htpt_, d6htpu_, d6htpv_, d6htpw_, d6htpx_, d6htpy_, d6htpz_ |