SCOP 1.71: Domain d1lzd__: 1lzd -

Lineage for d1lzd__ (1lzd -)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (7 families)

5. Family d.2.1.2: C-type lysozyme [53960] (2 proteins)

6. Protein Lysozyme [53961] (14 species)
   ubiquitous in a variety of tissues and secretions

7. Species Chicken (Gallus gallus) [TaxId:9031] [53962] (190 PDB entries)

8. Domain d1lzd__: 1lzd - [36335]
   mutant

Details for d1lzd__

PDB Entry: 1lzd, 1.8 Å

PDB Description: dissection of protein-carbohydrate interactions in mutant hen egg- white lysozyme complexes and their hydrolytic activity

SCOP Domain Sequences for d1lzd__:

Sequence; same for both SEQRES and ATOM records:

>d1lzd__ d.2.1.2 (-) Lysozyme {Chicken (Gallus gallus)}
kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfntqatnrntdgstdygilqins
rywcndgrtpgsrnlcnipcsallssditasvncakkivsdgngmnawvawrnrckgtdv
qawirgcrl

Timeline for d1lzd__:

• d1lzd__ first appeared (with stable ids) in SCOP 1.55
  
• d1lzd__ appears in SCOP 1.69
  
• d1lzd__ is called d1lzda_ in SCOP 1.73
  
• d1lzd__ appears in the current release, SCOPe 2.08, called d1lzda_