Lineage for d1at5__ (1at5 -)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 76064Fold d.2: Lysozyme-like [53954] (1 superfamily)
  4. 76065Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 76074Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 76107Protein Lysozyme [53961] (14 species)
  7. 76115Species Chicken (Gallus gallus) [TaxId:9031] [53962] (142 PDB entries)
  8. 76162Domain d1at5__: 1at5 - [36334]

Details for d1at5__

PDB Entry: 1at5 (more details), 1.8 Å

PDB Description: hen egg white lysozyme with a succinimide residue

SCOP Domain Sequences for d1at5__:

Sequence, based on SEQRES records: (download)

>d1at5__ d.2.1.2 (-) Lysozyme {Chicken (Gallus gallus)}
kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfntqatnrntdgstdygilqins
rwwcndgrtpgsrnlcnipcsallssditasvncakkivsxxngmnawvawrnrckgtdv
qawirgcrl

Sequence, based on observed residues (ATOM records): (download)

>d1at5__ d.2.1.2 (-) Lysozyme {Chicken (Gallus gallus)}
kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfntqatnrntdgstdygilqins
rwwcndgrtpgsrnlcnipcsallssditasvncakkivsngmnawvawrnrckgtdvqa
wirgcrl

SCOP Domain Coordinates for d1at5__:

Click to download the PDB-style file with coordinates for d1at5__.
(The format of our PDB-style files is described here.)

Timeline for d1at5__: