Lineage for d6fn8a_ (6fn8 A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2360693Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 2360694Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)
  6. 2360695Protein Copper chaperone for superoxide dismutase, C-terminal domain [49341] (2 species)
  7. 2360702Species Human (Homo sapiens) [TaxId:9606] [49343] (4 PDB entries)
  8. 3063276Domain d6fn8a_: 6fn8 A: [363338]
    automated match to d1do5a_
    complexed with zn

Details for d6fn8a_

PDB Entry: 6fn8 (more details), 1.55 Å

PDB Description: domain ii of the human copper chaperone for superoxide dismutase at 1.55 a resolution
PDB Compounds: (A:) copper chaperone for superoxide dismutase

SCOPe Domain Sequences for d6fn8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fn8a_ b.1.8.1 (A:) Copper chaperone for superoxide dismutase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
nlgaavailggpgtvqgvvrflqltpercliegtidglepglhglhvhqygdltnncnsc
gnhfnpdgashggpqdsdrhrgdlgnvradadgraifrmedeqlkvwdvigrsliidege
ddlgrgghplskitgnsgerlacgiiarsag

SCOPe Domain Coordinates for d6fn8a_:

Click to download the PDB-style file with coordinates for d6fn8a_.
(The format of our PDB-style files is described here.)

Timeline for d6fn8a_:

  • d6fn8a_ appears in periodic updates to SCOPe 2.07 starting on 2019-02-05