Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries) |
Domain d6hucp_: 6huc P: [363336] Other proteins in same PDB: d6huca_, d6hucc2, d6huce_, d6hucg_, d6huci_, d6hucj_, d6huck_, d6hucl_, d6hucn_, d6huco_, d6hucq2, d6hucs_, d6hucu_, d6hucw_, d6hucx_, d6hucy_, d6hucz_ automated match to d4cr2c_ complexed with cl, grt, mg, so4 |
PDB Entry: 6huc (more details), 3 Å
SCOPe Domain Sequences for d6hucp_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hucp_ d.153.1.4 (P:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk tgit
Timeline for d6hucp_:
View in 3D Domains from other chains: (mouse over for more information) d6huca_, d6hucb_, d6hucc1, d6hucc2, d6hucd_, d6huce_, d6hucf_, d6hucg_, d6huch_, d6huci_, d6hucj_, d6huck_, d6hucl_, d6hucm_, d6hucn_, d6huco_, d6hucq1, d6hucq2, d6hucr_, d6hucs_, d6huct_, d6hucu_, d6hucv_, d6hucw_, d6hucx_, d6hucy_, d6hucz_ |