Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186944] (65 PDB entries) |
Domain d6e90c1: 6e90 C:3-193 [363222] Other proteins in same PDB: d6e90a2, d6e90b2, d6e90c2, d6e90d2 automated match to d1wpqa1 complexed with 13p, ca, mpd, nad, po4 |
PDB Entry: 6e90 (more details), 2.05 Å
SCOPe Domain Sequences for d6e90c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6e90c1 c.2.1.0 (C:3-193) automated matches {Human (Homo sapiens) [TaxId: 9606]} skkvcivgsgnwgsaiakivggnaaqlaqfdprvtmwvfeediggkklteiintqhenvk ylpghklppnvvavpdvvqaaedadilifvvphqfigkicdqlkghlkanatgislikgv degpnglklisevigerlgipmsvlmganiasevadekfcettigckdpaqgqllkelmq tpnfritvvqe
Timeline for d6e90c1: