SCOPe 2.08: Domain d6e90c1: 6e90 C:3-193

Lineage for d6e90c1 (6e90 C:3-193)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186944] (65 PDB entries)

8. Domain d6e90c1: 6e90 C:3-193 [363222]
   Other proteins in same PDB: d6e90a2, d6e90b2, d6e90c2, d6e90d2
   automated match to d1wpqa1
   complexed with 13p, ca, mpd, nad, po4

Details for d6e90c1

PDB Entry: 6e90, 2.05 Å

PDB Description: ternary complex of human glycerol 3-phosphate dehydrogenase

PDB Compounds: (C:) Glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic

SCOPe Domain Sequences for d6e90c1:

Sequence; same for both SEQRES and ATOM records:

>d6e90c1 c.2.1.0 (C:3-193) automated matches {Human (Homo sapiens) [TaxId: 9606]}
skkvcivgsgnwgsaiakivggnaaqlaqfdprvtmwvfeediggkklteiintqhenvk
ylpghklppnvvavpdvvqaaedadilifvvphqfigkicdqlkghlkanatgislikgv
degpnglklisevigerlgipmsvlmganiasevadekfcettigckdpaqgqllkelmq
tpnfritvvqe

Timeline for d6e90c1:

• d6e90c1 first appeared in SCOPe 2.07