Lineage for d6fg5a_ (6fg5 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736615Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2736616Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) (S)
  5. 2736712Family a.211.1.2: PDEase [48548] (7 proteins)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 2737088Protein automated matches [190370] (2 species)
    not a true protein
  7. 2737089Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [361055] (2 PDB entries)
  8. 2737092Domain d6fg5a_: 6fg5 A: [363212]
    automated match to d3g58a_
    complexed with mg, zn

Details for d6fg5a_

PDB Entry: 6fg5 (more details), 2.35 Å

PDB Description: schistosoma mansoni phosphodiesterase 4a
PDB Compounds: (A:) phosphodiesterase

SCOPe Domain Sequences for d6fg5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fg5a_ a.211.1.2 (A:) automated matches {Blood fluke (Schistosoma mansoni) [TaxId: 6183]}
flpihgvetpndneleerfslcldewgvdifeidrlsnghalttvayrifqkrdllktfc
idphvfvryllrvestyhadvpyhnsmhaadvlqtahfllqaealddvfsdleilavlfa
aaihdvdhpgvtnqflintghelalqyndasvlenhhlymafkiltekdcdifanlggkk
rqtlrrmvielvlatdmskhmslladlrtmvetkkvsgsgmlnldnyadriqilqnmihc
adlsnpakplrlyrkwtgrlieeffrqgdkerelsleispmcdresveveksqvsfidfv
chplwetwcdlvhpcaqlildtlednrdwyechi

SCOPe Domain Coordinates for d6fg5a_:

Click to download the PDB-style file with coordinates for d6fg5a_.
(The format of our PDB-style files is described here.)

Timeline for d6fg5a_: