SCOPe 2.08: Domain d6fcmc2: 6fcm C:127-256

Lineage for d6fcmc2 (6fcm C:127-256)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (3 families)

5. Family d.131.1.0: automated matches [227185] (1 protein)
   not a true family

6. Protein automated matches [226907] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [254935] (6 PDB entries)

8. Domain d6fcmc2: 6fcm C:127-256 [363130]
   automated match to d1plqa2

Details for d6fcmc2

PDB Entry: 6fcm, 2.8 Å

PDB Description: crystal structure of human pcna

PDB Compounds: (C:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d6fcmc2:

Sequence, based on SEQRES records:

>d6fcmc2 d.131.1.0 (C:127-256) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngniklsqts
nvdkeeeavtiemnepvqltfalrylnfftkatplsstvtlsmsadvplvveykiadmgh
lkyylapkie

Sequence, based on observed residues (ATOM records):

>d6fcmc2 d.131.1.0 (C:127-256) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngniklsqts
nkeeeavtiemnepvqltfalrylnfftkatplsstvtlsmsadvplvveykiadmghlk
yylapkie

Timeline for d6fcmc2:

• d6fcmc2 first appeared in SCOPe 2.07