Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily) 8-stranded mixed beta-sheet; 2 layers: alpha/beta |
Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) |
Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins) |
Protein automated matches [190229] (13 species) not a true protein |
Species Candida albicans [TaxId:237561] [363057] (6 PDB entries) |
Domain d6cjla1: 6cjl A:7-218 [363090] Other proteins in same PDB: d6cjla2, d6cjlb2 automated match to d4xkaa_ complexed with mg, rdc |
PDB Entry: 6cjl (more details), 1.7 Å
SCOPe Domain Sequences for d6cjla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6cjla1 d.122.1.1 (A:7-218) automated matches {Candida albicans [TaxId: 237561]} etheftaeisqlmsliintvysnkeiflrelisnasdaldkiryqalsdpsqlesepelf iriipqkdqkvleirdsgigmtkadlvnnlgtiaksgtksfmealsagadvsmigqfgvg fyslflvadhvqviskhnddeqyvwesnaggkftvtldetnerlgrgtmlrlflkedqle yleekrikevvkkhsefvaypiqlvvtkevek
Timeline for d6cjla1: