Lineage for d6cjia1 (6cji A:7-218)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2537076Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2537077Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2537078Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)
  6. 2537320Protein automated matches [190229] (12 species)
    not a true protein
  7. 3062995Species Candida albicans [TaxId:237561] [363057] (6 PDB entries)
  8. 3063020Domain d6cjia1: 6cji A:7-218 [363082]
    Other proteins in same PDB: d6cjia2
    automated match to d4xkaa_
    complexed with edo

Details for d6cjia1

PDB Entry: 6cji (more details), 1.64 Å

PDB Description: candida albicans hsp90 nucleotide binding domain
PDB Compounds: (A:) Heat shock protein 90 homolog

SCOPe Domain Sequences for d6cjia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cjia1 d.122.1.1 (A:7-218) automated matches {Candida albicans [TaxId: 237561]}
etheftaeisqlmsliintvysnkeiflrelisnasdaldkiryqalsdpsqlesepelf
iriipqkdqkvleirdsgigmtkadlvnnlgtiaksgtksfmealsagadvsmigqfgvg
fyslflvadhvqviskhnddeqyvwesnaggkftvtldetnerlgrgtmlrlflkedqle
yleekrikevvkkhsefvaypiqlvvtkevek

SCOPe Domain Coordinates for d6cjia1:

Click to download the PDB-style file with coordinates for d6cjia1.
(The format of our PDB-style files is described here.)

Timeline for d6cjia1:

  • d6cjia1 appears in periodic updates to SCOPe 2.07 starting on 2019-02-05

View in 3D
Domains from same chain:
(mouse over for more information)
d6cjia2