Lineage for d6c68b1 (6c68 B:1-111)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760496Domain d6c68b1: 6c68 B:1-111 [363072]
    Other proteins in same PDB: d6c68a2, d6c68b2, d6c68c2, d6c68d2
    automated match to d3of6c1

Details for d6c68b1

PDB Entry: 6c68 (more details), 2.59 Å

PDB Description: mhc-independent t cell receptor a11
PDB Compounds: (B:) T-cell receptor beta chain

SCOPe Domain Sequences for d6c68b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6c68b1 b.1.1.0 (B:1-111) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
avtqsprskvavtggkvtlschqtnnhdymywyrqdtghglrlihysyvadstekgdipd
gykasrpsqenfslilelaslsqtavyfcassqtnsdytfgsgtrllvied

SCOPe Domain Coordinates for d6c68b1:

Click to download the PDB-style file with coordinates for d6c68b1.
(The format of our PDB-style files is described here.)

Timeline for d6c68b1: