Lineage for d6a78h_ (6a78 H:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2347168Protein automated matches [190119] (20 species)
    not a true protein
  7. 2347951Species Mouse (Mus musculus) [TaxId:10090] [186842] (175 PDB entries)
  8. 3063004Domain d6a78h_: 6a78 H: [363066]
    Other proteins in same PDB: d6a78a1, d6a78a2, d6a78b1, d6a78b2
    automated match to d1ar1c_
    complexed with so4

Details for d6a78h_

PDB Entry: 6a78 (more details), 2.1 Å

PDB Description: crystal structure of the fifth immunoglobulin domain (ig5) of human robo1 in complex with the scfv fragment of murine monoclonal antibody b5209b
PDB Compounds: (H:) Heavy chain and linker region of the anti-human Robo1 antibody B5209B scFv

SCOPe Domain Sequences for d6a78h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6a78h_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlvesgggvvqpggslklscaasgftfstydmswvrqtpdkrlelvatinsnggstyy
pdsvkgrftssrdnaknilylqmsslksedtamyycareallrppyyaldywgqgtsvtv
s

SCOPe Domain Coordinates for d6a78h_:

Click to download the PDB-style file with coordinates for d6a78h_.
(The format of our PDB-style files is described here.)

Timeline for d6a78h_:

  • d6a78h_ appears in periodic updates to SCOPe 2.07 starting on 2019-02-05