Lineage for d6a79b1 (6a79 B:9-97)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (25 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1180 PDB entries)
  8. 3063002Domain d6a79b1: 6a79 B:9-97 [363064]
    Other proteins in same PDB: d6a79a2, d6a79b2, d6a79h_, d6a79i_, d6a79l_, d6a79m_
    automated match to d3kvqa_
    complexed with so4; mutant

Details for d6a79b1

PDB Entry: 6a79 (more details), 2.31 Å

PDB Description: crystal structure of the fifth immunoglobulin domain (ig5) of human robo1 in complex with the mutant scfv fragment (p103a) of murine monoclonal antibody b5209b
PDB Compounds: (B:) roundabout homolog 1

SCOPe Domain Sequences for d6a79b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6a79b1 b.1.1.0 (B:9-97) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvirqgpvnqtvavdgtfvlscvatgspvptilwrkdgvlvstqdsrikqlengvlqiry
aklgdtgrytciastpsgeatwsayievq

SCOPe Domain Coordinates for d6a79b1:

Click to download the PDB-style file with coordinates for d6a79b1.
(The format of our PDB-style files is described here.)

Timeline for d6a79b1:

  • d6a79b1 appears in periodic updates to SCOPe 2.07 starting on 2019-02-05