Lineage for d1a2yc_ (1a2y C:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 714012Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 714013Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 714022Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 714086Protein Lysozyme [53961] (14 species)
    ubiquitous in a variety of tissues and secretions
  7. 714094Species Chicken (Gallus gallus) [TaxId:9031] [53962] (256 PDB entries)
  8. 714125Domain d1a2yc_: 1a2y C: [36305]
    Other proteins in same PDB: d1a2ya_, d1a2yb_
    complexed with po4; mutant

Details for d1a2yc_

PDB Entry: 1a2y (more details), 1.5 Å

PDB Description: hen egg white lysozyme, d18a mutant, in complex with mouse monoclonal antibody d1.3
PDB Compounds: (C:) lysozyme

SCOP Domain Sequences for d1a2yc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a2yc_ d.2.1.2 (C:) Lysozyme {Chicken (Gallus gallus) [TaxId: 9031]}
kvfgrcelaaamkrhglanyrgyslgnwvcaakfesnfntqatnrntdgstdygilqins
rwwcndgrtpgsrnlcnipcsallssditasvncakkivsdgngmnawvawrnrckgtdv
qawirgcrl

SCOP Domain Coordinates for d1a2yc_:

Click to download the PDB-style file with coordinates for d1a2yc_.
(The format of our PDB-style files is described here.)

Timeline for d1a2yc_: