Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (22 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [186842] (212 PDB entries) |
Domain d6a79i_: 6a79 I: [363042] Other proteins in same PDB: d6a79a1, d6a79a2, d6a79b1, d6a79b2 automated match to d1ar1c_ complexed with so4; mutant |
PDB Entry: 6a79 (more details), 2.31 Å
SCOPe Domain Sequences for d6a79i_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6a79i_ b.1.1.1 (I:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} evqlvesgggvvqpggslklscaasgftfstydmswvrqtpdkrlelvatinsnggstyy pdsvkgrftssrdnaknilylqmsslksedtamyycareallrpayyaldywgqgtsvtv ss
Timeline for d6a79i_: