SCOPe 2.08: Domain d5zf1b1: 5zf1 B:1-121

Lineage for d5zf1b1 (5zf1 B:1-121)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families)

5. Family c.58.1.0: automated matches [227157] (1 protein)
   not a true family

6. Protein automated matches [226864] (40 species)
   not a true protein

7. Species Silkworm (Bombyx mori) [TaxId:7091] [362987] (1 PDB entry)

8. Domain d5zf1b1: 5zf1 B:1-121 [363027]
   Other proteins in same PDB: d5zf1a2, d5zf1b2
   automated match to d6apea1
   complexed with edo, so4

Details for d5zf1b1

PDB Entry: 5zf1, 1.75 Å

PDB Description: molecular structure of a novel 5,10-methylenetetrahydrofolate dehydrogenase from the silkworm, bombyx mori

PDB Compounds: (B:) 5,10-methylenetetrahydrofolate dehydrogenase

SCOPe Domain Sequences for d5zf1b1:

Sequence; same for both SEQRES and ATOM records:

>d5zf1b1 c.58.1.0 (B:1-121) automated matches {Silkworm (Bombyx mori) [TaxId: 7091]}
marildgkalameikkelkqkiaqwvslgnraptirciivgddpashtyvrnkveaakfv
gidaltinrdsditeeqllseiqnlnednsvdgilvqlpvpdtinerrvcdaiapekdid
g

Timeline for d5zf1b1:

• d5zf1b1 first appeared in SCOPe 2.07