SCOPe 2.08: Domain d5zjma1: 5zjm A:1-289

Lineage for d5zjma1 (5zjm A:1-289)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.0: automated matches [191319] (1 protein)
   not a true family

6. Protein automated matches [190115] (94 species)
   not a true protein

7. Species Fusobacterium nucleatum [TaxId:190304] [360904] (2 PDB entries)

8. Domain d5zjma1: 5zjm A:1-289 [362991]
   Other proteins in same PDB: d5zjma2, d5zjmb2, d5zjmc2, d5zjmd2
   automated match to d3lcgb_
   complexed with edo

Details for d5zjma1

PDB Entry: 5zjm, 2.32 Å

PDB Description: crystal structure of n-acetylneuraminate lyase from fusobacterium nucleatum

PDB Compounds: (A:) n-acetylneuraminate lyase

SCOPe Domain Sequences for d5zjma1:

Sequence; same for both SEQRES and ATOM records:

>d5zjma1 c.1.10.0 (A:1-289) automated matches {Fusobacterium nucleatum [TaxId: 190304]}
mkgiysalmvpynedgsinekglreiirynidkmkvdglyvggstgenfmisteekkrvf
eiaideakdsvnliaqvgsinlneavelgkyvtklgykclsavtpfyykfdfseikdyye
tivretgnymiiysipfltgvnmslsqfgelfenekiigvkftagdfyllervrkafpdk
lifagfdemllpatvlgvdgaigstyningirakqifelaknskidealkiqhttndlie
gilsnglyqtikeilklegvdagycrkpmkkisqkqiefakelhkkflk

Timeline for d5zjma1:

• d5zjma1 first appeared in SCOPe 2.07