Lineage for d5zf1a2 (5zf1 A:122-299)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2848471Species Silkworm (Bombyx mori) [TaxId:7091] [362989] (1 PDB entry)
  8. 2848472Domain d5zf1a2: 5zf1 A:122-299 [362990]
    Other proteins in same PDB: d5zf1a1, d5zf1b1
    automated match to d6apea2
    complexed with edo, so4

Details for d5zf1a2

PDB Entry: 5zf1 (more details), 1.75 Å

PDB Description: molecular structure of a novel 5,10-methylenetetrahydrofolate dehydrogenase from the silkworm, bombyx mori
PDB Compounds: (A:) 5,10-methylenetetrahydrofolate dehydrogenase

SCOPe Domain Sequences for d5zf1a2:

Sequence, based on SEQRES records: (download)

>d5zf1a2 c.2.1.0 (A:122-299) automated matches {Silkworm (Bombyx mori) [TaxId: 7091]}
fhiinigrlcvdlptivpatalavvemlkrfnidtfgrnavvigrsknvgmpiammlhsd
krhesglgmdatvtichrytpkdkleaycrnadiiitatglpklikadmvkpgatiidvg
ittrtdengksrlvgdvdyeevskiagaitpvpggvgpmtvamlmhntfqaaqsqank

Sequence, based on observed residues (ATOM records): (download)

>d5zf1a2 c.2.1.0 (A:122-299) automated matches {Silkworm (Bombyx mori) [TaxId: 7091]}
fhiinigrlcvdlptivpatalavvemlkrfnidtfgrnavvigrsknvgmpiammlhsd
krhesglgmdatvtichrytpkdkleaycrnadiiitatglpklikadmvkpgatiidvg
ittrlvgdvdyeevskiagaitpvpggvgpmtvamlmhntfqaaqsqank

SCOPe Domain Coordinates for d5zf1a2:

Click to download the PDB-style file with coordinates for d5zf1a2.
(The format of our PDB-style files is described here.)

Timeline for d5zf1a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5zf1a1