Lineage for d6q91d1 (6q91 D:8-216)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2930059Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2930060Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2930509Family d.14.1.5: GHMP Kinase, N-terminal domain [54232] (7 proteins)
  6. 2930576Protein automated matches [232306] (2 species)
    not a true protein
  7. 2930577Species Human (Homo sapiens) [TaxId:9606] [362871] (16 PDB entries)
  8. 2930627Domain d6q91d1: 6q91 D:8-216 [362927]
    Other proteins in same PDB: d6q91a2, d6q91a3, d6q91b2, d6q91b3, d6q91c2, d6q91c3, d6q91d2
    automated match to d1wuua1
    complexed with gal, hfk, hr8

Details for d6q91d1

PDB Entry: 6q91 (more details), 2.4 Å

PDB Description: structure of human galactokinase 1 bound with 5-chloro-n-isobutyl-2- methoxybenzamide
PDB Compounds: (D:) Galactokinase

SCOPe Domain Sequences for d6q91d1:

Sequence, based on SEQRES records: (download)

>d6q91d1 d.14.1.5 (D:8-216) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvaellaearrafreefgaepelavsapgrvnligehtdynqglvlpmalelmtvlvgsp
rkdglvsllttsegadepqrlqfplptaqrslepgtprwanyvkgviqyypaaplpgfsa
vvvssvplggglsssaslevatytflqqlcpdsgtiaaraqvcqqaehsfagmpcgimdq
fislmgqkghallidcrsletslvplsdp

Sequence, based on observed residues (ATOM records): (download)

>d6q91d1 d.14.1.5 (D:8-216) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvaellaearafreefgaepelavsapgrvnligehtdynqglvlpmalelmtvlvgspd
glvsllttrlqfplptslepgtprwanyvkgviqyypaaplpgfsavvvssvplggglss
saslevatytflqqlcpdsgtiaaraqvcqqaehsmdqfislmgqkghallidcrslets
lvplsdp

SCOPe Domain Coordinates for d6q91d1:

Click to download the PDB-style file with coordinates for d6q91d1.
(The format of our PDB-style files is described here.)

Timeline for d6q91d1: