Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) |
Family d.14.1.5: GHMP Kinase, N-terminal domain [54232] (7 proteins) |
Protein automated matches [232306] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [362871] (16 PDB entries) |
Domain d6q91d1: 6q91 D:8-216 [362927] Other proteins in same PDB: d6q91a2, d6q91a3, d6q91b2, d6q91b3, d6q91c2, d6q91c3, d6q91d2 automated match to d1wuua1 complexed with gal, hfk, hr8 |
PDB Entry: 6q91 (more details), 2.4 Å
SCOPe Domain Sequences for d6q91d1:
Sequence, based on SEQRES records: (download)
>d6q91d1 d.14.1.5 (D:8-216) automated matches {Human (Homo sapiens) [TaxId: 9606]} qvaellaearrafreefgaepelavsapgrvnligehtdynqglvlpmalelmtvlvgsp rkdglvsllttsegadepqrlqfplptaqrslepgtprwanyvkgviqyypaaplpgfsa vvvssvplggglsssaslevatytflqqlcpdsgtiaaraqvcqqaehsfagmpcgimdq fislmgqkghallidcrsletslvplsdp
>d6q91d1 d.14.1.5 (D:8-216) automated matches {Human (Homo sapiens) [TaxId: 9606]} qvaellaearafreefgaepelavsapgrvnligehtdynqglvlpmalelmtvlvgspd glvsllttrlqfplptslepgtprwanyvkgviqyypaaplpgfsavvvssvplggglss saslevatytflqqlcpdsgtiaaraqvcqqaehsmdqfislmgqkghallidcrslets lvplsdp
Timeline for d6q91d1: