Lineage for d5w7hb_ (5w7h B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2833366Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2833482Family c.1.9.3: Phosphotriesterase-like [51564] (3 proteins)
    automatically mapped to Pfam PF02126
  6. 2833483Protein Phosphotriesterase (parathion hydrolase, PTE) [51565] (5 species)
  7. 2833595Species Rhizobium radiobacter [TaxId:358] [362917] (1 PDB entry)
  8. 2833597Domain d5w7hb_: 5w7h B: [362918]
    automated match to d3e3ha_
    complexed with zn

Details for d5w7hb_

PDB Entry: 5w7h (more details), 2.75 Å

PDB Description: supercharged arpte variant r5
PDB Compounds: (B:) phosphotriesterase

SCOPe Domain Sequences for d5w7hb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w7hb_ c.1.9.3 (B:) Phosphotriesterase (parathion hydrolase, PTE) {Rhizobium radiobacter [TaxId: 358]}
tgdlintvrgpipvseagftlthehicgssagflrawpeffgsrkalvekavrglrhara
agvqtivdvstfdigrdvrllaevsraadvhivaatglwfdpplsmrmrsveeltrfflr
eirhgiedtgiragiikvattgkatpfqelvlraaaraslatgvpvtthtsgsqrdgeqq
aaifeseglspsrvcighsddtddlryltglaargylvgldrmpysaiglrgnasalalf
gtrswqtrallikalidrgykdrilvshdwlfgfssyvtnimrvmdrinpdgmafvplrv
ipflrekgvppetlagvtvanparflspt

SCOPe Domain Coordinates for d5w7hb_:

Click to download the PDB-style file with coordinates for d5w7hb_.
(The format of our PDB-style files is described here.)

Timeline for d5w7hb_: