Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
Protein automated matches [190329] (10 species) not a true protein |
Species Malayan pit viper (Calloselasma rhodostoma) [TaxId:8717] [188489] (10 PDB entries) |
Domain d6ndfe_: 6ndf E: [362891] Other proteins in same PDB: d6ndfc_, d6ndff_, d6ndfi_, d6ndfl_, d6ndfo_, d6ndfr_ automated match to d1v7pb_ complexed with cl, na, nh4, so4, sr |
PDB Entry: 6ndf (more details), 3.05 Å
SCOPe Domain Sequences for d6ndfe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ndfe_ d.169.1.1 (E:) automated matches {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} cplhwssyngycyrvfselktwedaesfcyaqhkgsrlasihsreeeafvgklasqtlky tsmwlglnnpwkeckwewsddakldykvwlrrpycavmvvktdrifwfnrgcektvsfvc kf
Timeline for d6ndfe_: