![]() | Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
![]() | Fold d.2: Lysozyme-like [53954] (1 superfamily) |
![]() | Superfamily d.2.1: Lysozyme-like [53955] (7 families) ![]() |
![]() | Family d.2.1.2: C-type lysozyme [53960] (2 proteins) |
![]() | Protein Lysozyme [53961] (14 species) |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [53962] (142 PDB entries) |
![]() | Domain d1fdly_: 1fdl Y: [36288] Other proteins in same PDB: d1fdlh1, d1fdlh2, d1fdll1, d1fdll2 |
PDB Entry: 1fdl (more details), 2.5 Å
SCOP Domain Sequences for d1fdly_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fdly_ d.2.1.2 (Y:) Lysozyme {Chicken (Gallus gallus)} kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfntqatnrntdgstdygilqins rwwcndgrtpgsrnlcnipcsallssditasvncakkivsdgngmnawvawrnrckgtdv qawirgcrl
Timeline for d1fdly_:
![]() Domains from other chains: (mouse over for more information) d1fdlh1, d1fdlh2, d1fdll1, d1fdll2 |