![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.62: vWA-like [53299] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
![]() | Superfamily c.62.1: vWA-like [53300] (6 families) ![]() |
![]() | Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins) |
![]() | Protein automated matches [190060] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186779] (23 PDB entries) |
![]() | Domain d6ndgf_: 6ndg F: [362837] Other proteins in same PDB: d6ndga_, d6ndgb_, d6ndgd_, d6ndge_, d6ndgg_, d6ndgh_, d6ndgj_, d6ndgk_, d6ndgm_, d6ndgn_, d6ndgp_, d6ndgq_ automated match to d1aoxb_ complexed with cl, na, nh4, so4, y1 |
PDB Entry: 6ndg (more details), 3.15 Å
SCOPe Domain Sequences for d6ndgf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ndgf_ c.62.1.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]} lidvvvvcdesnsiypwdavknflekfvqgldigptktqvgliqyannprvvfnlntykt keemivatsqtsqyggdltntfgaiqyarkyaysaasggrrsatkvmvvvtdgeshdgsm lkavidqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvsdeaall ekagtlgeqif
Timeline for d6ndgf_: